TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9WXR6|Q9WXR6_THEMA ABC-type transporter, integral membrane subunit OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0060 PE=3 SV=1
MLAYIAKRVLYAIPLLFVISIVSFIIIELPPGDYLTTYVMTLRQSGETIDQAALEVLKKRYGLDKPVIVRYFYWIGNIIT
KGDFGYSFMWEKPVSDLLNQRVWWTILISVLSTAFAWVFGFLIGVYSGTHQYSIGDYVFTVLGYIGLATPNFLLALILLW
FMFVTTGVSLGGLFSPEYAGAPWSWAKFVDLLKHIWIPVVVLGTGSMAGLIRVLRANLLDEINKPYVVAARARGVPEREL
VWKYPLRVAVIPFASTAGWALPQIVSGAVVTGIVLNLPTVGTLLLDALTSQDMYLAGSLVLILSVFTIIGTLISDILLAW
LDPRIRFE