TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q9X051|RBSA2_THEMA Ribose import ATP-binding protein RbsA 2 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rbsA2 PE=3 SV=1
MMLNTEKEREVLLEARNITKTFPGVIAVNNVTLQIYKGEVCALVGENGAGKSTLMKILAGVYPDYEGQIFLEGKEVRFRN
PREAQENGIALIPQELDLVPNLSSAENIFLSREPVNEFGVIEYQKMFEQASKLFSKLGVNIDPKTKVEDLSTSQQQMVAI
AKALSLDAKIIIMDEPTSAIGKRETEQLFNIIRSLKNEGKSVIYISHRLEEIFEIADRVVVMRDGRKVGEGPIEEFDHDK
LVRLMVGRSIDQFFIKERATITDEIFRVEGIKLWSLDRKKLLVDDVSFYVRKGEVLGIYGLVGAGRTELLEAIFGAHPGR
TEGKVFIGGKEIKIHSPRDAVKNGIGLVPEDRKTAGLILQMSVLHNITLPSVVMKLIVRKFGLIDSQLEKEIVRSFIEKL
NIKTPSPYQIVENLSGGNQQKVVLAKWLAIKPKVLLLDEPTRGIDVNAKSEIYKLISEMAVSGMGVVMVSSELPEILAMS
DRILVMSEGRKTAEFLREEVTEEDLLKAAIPRSVKVETTQREE