TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q9X4Y1|AGPA_RHIME Periplasmic alpha-galactoside binding protein precursor - Rhizobium meliloti (Sinorhizobium meliloti).
MKTHRLNMTASLLIGISAFAVQAFASEPTVVPEQPPFPAQGKITYVSRDSILEFKALREYREPEWVTEKFVKAGKLPPVA
ERLPKEPMVFKAGNMPDGMGVYGDVMRHVIGGRPEGWNYSAGQTQGWGGIDIGMFECLTRTAPLFQVEADDMEPLPNLAK
SWDWSEDGRKLTMHLIEGAKWSDGDPFDADDVMFYWEDNVLDSSVSPLNGATPETFGEGTTLKKIDQYTVEWTFKEAFPR
QHLFAMAYGTFCPGPSHILKTKHPKYAGTTYNEYKNGFPAEYMNLPVMGAWVPVAYRPDDIIVLRRNPYYWKVDEAGNQL
PYLNELHYKLSTWADRDVQAIAGSGDISNLEQPENFVESLKRAANESAPARLAFGPRVIGYNMHMNFSGNGWGDPDERAK
AVRELNRNLDFRKAVTMAVDRKKLGEALVKGPFTAIYPGGLSSGTSFYDRNSTIYYPHDLEGAKVLLEKVGLKDTDGNGF
VNFPAGKLGGRDVEIVLLVNSDYSTDRNLAEGMVGQMEKLGLRVVLNALDGKQRDAANYAGRFDWMIHRNTAEFASVVQN
TPQLAPTGPRTSWHHRAPEGGEVDVMPHEQELVDIVNKFIASNDNDERTELMKQYQKVATTNVDTVGLTEYPGALIINKR
FSNIPPGAPIFMFNWAEDTIIRERVFVAADKQGDYELYPEQLPGKPGESGPIN