TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9XA52|Q9XA52_STRCO Putative ion channel membrane protein OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO3826 PE=4 SV=1
MKLPGQDAIARQADEHFVTYKVKLPRKLVEHPFRQVAKRLSIALLVLVVTAVIVYADHDGYTDNSDGSVDLLDSFYYATV
TLSTTGYGDITPVSDAARLTNIFVITPLRVLFLIILVGTTLEALTERTREEWRLNRWRSALRDHTVVVGFGTKGRSAIQT
VCATGLRKDQVVVVDPSGKAIEAATAHGYAGVVGDATRSDVLNRAEAYRAKQIIIATQRDDTAVLVTLTARQLNRGAKIV
VAVREEENAPLLKQSGADAVITSASAAGRLLGLSVLSPAAGMVMEDLISQGSGLDLVERPVIKAEVGKHPREMDDLVVSV
LRGHRVLGYDDPAVGGLELADRLITIVRATPATHVAPDARPLPRD