TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9ZE70 Hypothetical protein RP076 - Rickettsia prowazekii.
MNDALKTYLNGICWFLLSLVTSSINDVMSKYLGTRLHSFEVAFFRFFFSSIVLLPFVVYYGKNALKTSRPFVHVLRGLLL
FFGMTSWTYGLTIAPVTTATVVSFAIPLFTLILAVFILNENIIWQRWVVTVVGFIGLVVMLKPHTKDFNPEILYLILAAI
SFAMLDIINKKFVVKESMLSMLFYSAIVTAMVSLPVAMQYWITPSSFELALLFVLGSSGSFILFFLLKAFSIVDATATAP
YRYLELVISAIAAYFIFNEFPDKSTVHGAVIIIPATLFIIYSEKKSMSSKHESQ