TCDB is operated by the Saier Lab Bioinformatics Group
>Q9ZHF3|PILQ_NEIME Type IV pilus biogenesis and competence protein pilQ - Neisseria meningitidis.
MNTKLTKIISGLFVATAAFQTASAGNITDIKVSSLPNKQKIVKVSFDKEIVNPTGFVTSSPARIALDFEQTGISMDQQVL
EYADPLLSKISAAQNSSRARLVLNLNKPGQYNTEVRGNKVWIFINESDDTVSAPARPAVKAAPAAPAKQQAAAPSTKSAV
SVSEPFTPAKQQAAAPFTESVVSVSAPFSPAKQQAAASAKQQAAAPAKQQAAASAKQQAAAPAKQQAAAPAKQTNIDFRK
DGKNAGIIELAALGFAGQPDISQQHDHIIVTLKNHTLPTALQRSLDVADFKTPVQKVTLKRLNNDTQLIITTAGNWELVN
KSAAPGYFTFQVLPKKQNLESGGVNNAPKTFTGRKISLDFQDVEIRTILQILAKESGMNIVASDSVSGKMTLSLKDVPWD
QALDLVMQARNLDMRQQGNIVNMAPRRAACQRQSLLTTGKRHCRSGRAVFPKLPIEIQKCGRIPQHPALDNADTTGNRNT
LVSGRGSVLIDPATNTLIVTDTRSVIEKFRKLIDELDVPAQQVMIEARIVEAADGFSRDLGVKFGATGRKKLKNETSAFG
WGVNSGFGGGDKWEAKPKSTCRLPCRKQHFAGARDFSGALNLELSASESLSKPKTLANPRVLTQNRKEAKIESGYEIPFT
VTSRSGGGSSTNTELKKAVLGLTVTPNITPDGQIIMTVKINKDSPRQCASGNQTILCISTKNLNTQAMVENGGTLIVGGI
YEEDNGNTLTKVPLLATSPLSATSLKHGEKNRPPRTADFQLPPREL