TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q9ZUT3|ALS3_ARATH Protein ALUMINUM SENSITIVE 3 OS=Arabidopsis thaliana GN=ALS3 PE=1 SV=1
MDLKWDDFFNDYEWLIVFLKGMVKPAAALVVVLLAVILSYSQNLSLEGEMIYSVSRSFLQLSVIGFVLQFIFNQENSGWI
ILAYLFMVSVAGYTAGQRARHVPRGKYVAGLSILAGTSITMFLLVLLNVFPFTPRYMIPIAGMLVGNAMTVTGVTMKQLR
DDIKMQLNLVETALALGATPRQATLQQVKRALVISLSPVLDSCKTVGLISLPGAMTGMIMGGASPLEAIQLQIVVMNMMV
GAATVSSITSTYLCWPSFFTKAYQLQTHVFSSD