TCDB is operated by the Saier Lab Bioinformatics Group
>QKK87500.1 multidrug efflux RND transporter periplasmic adaptor subunit MexV [Pseudomonas aeruginosa]
MLLRRMLIMLAAVIAVVAILAGYKVYSIRQQIALFSAPKPPISVTASLAEKRPWQSRLPAIGSLKAFQGVTLTAEVSGTV
RDVLFLSGDQVKLDQPLIQLESDVEEATLRTAEADLGLARAEYQRGRELIGSKAISKSEFDRLAAQWAKTSATVAELKAA
LAKKRVLAPFAGTIGIRQVDVGDYVSPGTPIATLQDLSTLLLDFHLPEQDFPLLSRGQLVKVRVAAYPAQVFDAEIAAIN
PKVDNETRNLQVRAALENPDGKLLPGMFANLEVMLPGEEQRVVVPETAITFTLYGDSIYVVGQKKDEQGQVSKDDKGQPQ
QVVERRFVRIGERREGLAVVLEGLEGGEQVVTSGQLKLDNGAAVAIVAERDLQQEH