TCDB is operated by the Saier Lab Bioinformatics Group
>tr|R4GK65|R4GK65_CHICK Uncharacterized protein OS=Gallus gallus OX=9031 GN=OTOP3 PE=4 SV=4
MAGNKASKQKFCHHCNSRSASAPPGTSTIHYEKSWLYRHCSLQQRDRQAQKSGQLFSGLLALNVVFLGSAFISSMIFNHV
AITLADVWILLSILKVLCLCWIIYYLLGTSRQPHAVLYRDTHAGPVWIRGSLLLFGTFSILLNVFQIGYSVIQINCKSKV
EIVFPSIEILFVATQAFFLWHHSKDCIQVQHNLTRCGLMLTIATNLLLWLLAVTNDSIHMEIESQLREVEQRLAGNETDS
CACPNTTTCKVFQKGYILLYPFNTEYCLICCSVLYVMWKNVGRRISHHHIAHIKPKFKLQGVVFGPLLGAAAVIIGICVF
MMYQIQATGSAPNYQVFVLYYSYYIVLLPLMCVVAIIGTIIHTLEKRELDTLKNPTRSLDVVLLMGAALGQIAMSYFSIV
AIVATNPRDMLNSLILSYSVLLIFQYITQNIFIIDGLQRQPFAAAEAQHTTHAGQLSAVPELPGEGVTTPSSNQERSQTF
PSKEEEVSEEHNREAPDQRRVSVLELGQEFRRVSLSYIHTYSHLGWKRKALKEISFFLVLCNIILWIMPTFGAHPVFENG
LQKSFYGYSTWFAIVNFGLPLSVFYRMHSVGGLLEVYVSA