TCDB is operated by the Saier Lab Bioinformatics Group
>tr|R7QP87|R7QP87_CHOCR Uncharacterized protein OS=Chondrus crispus GN=CHC_T00000615001 PE=4 SV=1
MDSTYFFADDGTLNATGLVTGFNELKQVVEDNVSGLDTMFVLVSGYMVFLMQCGFAMLTAGSVRTKNTKNVLLKNILDAC
VGAIAYYLFGWAFAYGGDSKINGFIGSGNFALSASSEGDFDDFTGFFFQWAFAATAATIVSGSVAERTSFYAYISYAFFL
TAFVYPVVSHWVWGGGFLSNIFGHGMIDFAGCSVVHMVGGFAGLAGAAIVGPRYGRFNAEGKPVPMPGHSATLCTLGTFM
LWFGWYGFNPGSALGISGGAYTVVARCAVTTTIAAAAGGITTLVLKKVMDHIFDLLAVLNGILAGLVAITACCAFVEVWA
AVIIGAIGAAFPIHGAVGFWGALCSGIFNSKTYQAAAGLPDQQGGFVMDISEWKLFASNLVGCIIIVCWVLVLIVPFFFA
LNVMGLLRISESEELIGNDISKHGGPAYPNDPVGELEETNVSDSLAMDPDSSKHVDEV