TCDB is operated by the Saier Lab Bioinformatics Group
>RLE37864.1 hypothetical protein DRJ17_05575 [Candidatus Woesearchaeota archaeon]
MKLEIYARSLIAKFTQKVSNSFSNLKGKLNLGFSEFFQRQTFTKIFYYWIHVILVFGVSYYFLSYIPNNSITYHGQMITQ
DLTGLLNSIYFSFVTSTSLGYGDIAPLGIAKLLSVIEVISGLIIYGMIISKIVSVKQEKMLEEIHSMSEKEQINRLRSSF
YLYRSEINKYNYRINTEKATKAEINDLWMTFTSFDVALMDTVRIMKRLNKNDEFDIGLILNSIDLSLIRTYDLITLLDDK
QIMWRKNIAISTLGSILNNTNSVCKQLDIVQDKKIQSQIRDILKMKASINGQINKQIKNIITDKTAKVALEHTINTT