TCDB is operated by the Saier Lab Bioinformatics Group
>RZF35587.1 hypothetical protein LSTR_LSTR005115 [Laodelphax striatellus]
MVLKTSNIPYSISSYPVPAITVCDAFGLDMFSLPEDVSEDANILYEMNFTRFVEIVLPNHGLDGTNSGIVKSLTPSNNSK
VFRVRDKFFLDLFNSRTFKNQESIDSSFISDASLASDGPFMCYDSLTHHGYCFTCNIVPPSVMFNNNTVHHYFKPTFSID
PNATVENLGEKILGYPSAVVKSIKNQSIKTHKYPSLNKSPIYTFTHKTCGEPNKNVSNECKLTDQYKSHHRHFAFYTIHS
PWDMPSPFMRWYYDKRFINKELQILVNFSSLLMFEDKASIEKQAKDRKCFRPLEKQLVFFKYYTRRNCLLECFTKKILDK
CGCVPYFLPHTEDTDICEHEDTKACASKIMDDASVQASWVACGCYGACNHTQYRAISREIIPQPDRITQYTMVLRDDTVY
PSIRTSAETLEEVVVSSMTYLDMFFGVSLISLVEIAYYSLLIVMEYLGIDRSIRKIITGRLERKQKRQVFTVDQCPSVDK
LESEGQYEKCQFETNNLKKRIHLLHRIEF