TCDB is operated by the Saier Lab Bioinformatics Group
>tr|S2JQB2|S2JQB2_MUCC1 Uncharacterized protein OS=Mucor circinelloides f. circinelloides (strain 1006PhL) GN=HMPREF1544_11346 PE=4 SV=1
MPVTRRSSVEVGSNIELKKISHTNGNQHVDSSAASAVSEVTNPTSATPSVDIKTKSKLSIPFKSSWLMWWNSEEWWSCWI
GLIFFGCIASAVKHNIPQPEFLPWEKNPFHTFSTTGNFGLFVIFAVMGTLLWIAMAATKAPNYKRFPIGFVCVFMIALIS
KMLASNVVLKKGSVGDSIWAIILGCFIRNVMSFVTKSSILAPWLKVAQQTELYIAISLVLLCIDISVLRPLAPRALFVSW
IDTPTLFIVVAYFGWKVLKIDTQTAIIMSGATFICGSSAAIALGASMGVPHKTEMPIAIISIFTIPSIIALPYVAKRMAL
SATVSGAWFGGCVDSTGAVIAAASIYGDHDAINTSAIVKMMQNVLIGPLSVIMAWAWSRYELQAAYKREEELINRNENLD
DAVIQEQVLDDTAGEDSNTPSVKHPRNIHAPSKPKEKAYVLLWKRFPKFVIGFIITAVLFNTTISDDAETRTLVNDFCFY
VSEWFSTLSFVSIGMGLQLSDIKQNIRSLGKLVTLYIVAQMVDIVVTCVLAWTAFTYL