TCDB is operated by the Saier Lab Bioinformatics Group
>tr|S3D9Y7|S3D9Y7_GLAL2 14-3-3 protein OS=Glarea lozoyensis (strain ATCC 20868 / MF5171) GN=GLAREA_10264 PE=4 SV=1
MANVYPSSLLPWDFPKSSLPGPRKARPKTPSLRSCLLLTTVDFDAVSSMAQADVDMKFLSQFATNVDVDHPFLSKTLFTI
LGNLTMLSDRVIRARKLRRLDTTRDTKAVDLYCRIIWYAREGLKLLEEYILPMVANFGPLKVLCHKLRASYYHLYVLFHN
TPHIRMKSGGGQVSTPPGLKSPRVRKLDKGKAPERDNPGDDIYRPSSVQPTHPLEGGPVGGISPPPPDFAPNFLVPSADY
RPIALQCFQEATHLAEKLLWGSHPLRLSVRVEYSAFLYDCLHERDSSRQLAKATIAEVYNAQEGMDDDMFEDAAALVGIL
GKMMKRGLGSGSASTPGTSTGRTPPRKSTAEALPSPMGMINPI