TCDB is operated by the Saier Lab Bioinformatics Group
>SEJ34406.1 hypothetical protein SAMN05216514_1277 [Kandleria vitulina]
MDHLKYQLKIMRHSPIRFVIYLIYLLSVWLMGSYLYMKQPLISPMLQSIRFSYYIAVAFSLVTFYSLYRSHQQKTEEVME
STPFHHSTSLMIFMSTIILLWSLIIFFILLATVLFQYYTKDSLIFLILTFSINVLFPIIIFQMIVYLIFKITHRILGFIV
YLIVIFITSPLFYSIKISVTSPLLSRIPDAFMNCFRLFYNNGQWAMNLQYGLQLEKPRIINLFLFAFLCLFLIISIRHKI
CKAISLITALTMIIYGTLPYSYYRLDDETLRHDLRDYGFYDQAMEQSIKKQDTNYSIASYKMNIDIDRYLQADVSMNMHA
KEESDVYWLTLSHDYHVKKIVCKDMKNYKIDKDHIALYLNRKMKNTNVQIIYEGYHPKYYSNDQSIMLPGFFAWYPFAGK
QQLFLEYPDMGEGYNIYNKNKSYYELHLKTRCKTVTNLDNTYKGYSDSLTLIGGKIKILSDPIIKNMLVYTSKDKNAPLE
TYFKDNIKKTNEIIKDVFDLDVHLDQKKIIIVSDDLGRNYSNNDYIIYDDYILTNDALLYSLSIDSTMSYYLNKNTHSSK
LAKLYNFSISSLDMKAPYKSIYNELLSSCAEDEIKYKDYIKQAVKNVGEEQFIKQSVKMLIEDYSDEEIFKKMQVKTRRD
WHGNI