TCDB is operated by the Saier Lab Bioinformatics Group
>SSC11890.1 conserved protein of unknown function [Mesotoga infera]
MYNRLEDSTRIIIGIIGGIIYAVGVGLIIFSFASFFLAPAIGMVFTSMFTLVILGIVASSIGRALVGMARTRKYSGPLDD
QRSLRREVQEDMTYNYTFVSDREAKTERKKSQSYSRCPECDAENDDRASTCQNCGASLVGYKKCSLCYKLNEMDKRFCSN
CGHDFNLD