TCDB is operated by the Saier Lab Bioinformatics Group
>STD02561.1 Uncharacterized protein conserved in bacteria (DUF2141) [Elizabethkingia meningoseptica]
MRNAFFLLFIILFFSCARVGAPVGGEKDKTPPKVVASKPDSLAKNVPTSLKELRIDFDEYVTLKDASKQLVISPPIKKIK
KIIPSSMANKYILIQWEDTLKANTTYNFNFGNSIADNNEGNVLPYYNFVFSTGSTIDSLFISGNVDDVLRPRKKNSKETN
TNDKDKPLVVGLYKADAKDYKEKPYYISRVDPDGYFELNYLAAGDYNLVAFQDDNQNSIYDPGKERVAFLPEPLHLTEPK
KGLRLLLSPPKKKFKFVETKPVPGGLNMIFEGKPDDSLQIKQVGTVLSDFKIQHKPKSDSAYIWINPKGNDFKEASTNVK
FSFYNNVKKKIDTVSTYYKVNTKDELTLNNNSGTTLPPGSNLKLKANMALDKVDFAQWELKADSTTVVPFQAQISKTNPF
EIQVDAQLLAGKKYSLRVGKETVSAFYFKNAKPIIFNFDVGKSDDYGSLVFRLTNAPTAPFWVQLLNDNFDVVKEQKVEG
KTDIKFDNLKSETYSVRILVDNNKNGVWDGADFEKHIQPEEAYLYRRKMTVKPLWDKVEDWDLKDTSVNDKEDQEDSLMP
SGAGIKSIEEQEKEKAKEKAKDKDDKTKKEQNDLYQKQQQQLQNPGYQR