TCDB is operated by the Saier Lab Bioinformatics Group
>tr|T0C0E1|T0C0E1_9BACL Uncharacterized protein OS=Alicyclobacillus acidoterrestris ATCC 49025 GN=N007_01030 PE=4 SV=1
MQQRLNRTLGLIAIVAFGLTNEIASGLFFVSTQIQKTAPGVGSLVPLLMIVGGLITFITVIAYRYFFASGLIGAGGEYVM
LSKSVSQPIGFVSTFLAWFGLTGSLGSLSYTAPTFLATAASSIGLQGAAQFLSSNIGILIGGLVIIWAFWLIHVRGVRLA
GILAVIAMCIVLFVAILLMVVGFSTNQNTLASAVATHLHIPLNHILNASPAHHVSPGVAFGSALPVLFFGYLGLSTATQT
GGEAVNAQHTLPRGVLFTVSVVTVVYTVFAFAIYHAVPWRIIGGLSSMNYTDYTTSSGLLQFVMPHWLSAVINVLVALIV
IKTLLPIFLAQSRWVFAWSEDGILPSVFGRTHARYHTPVLALTISAIFGSISLIESIDLGYVFGVNLRVLSVMIVFFFMG
VGMIVFPKRSPERYRQNRSKLASLRWLQVLLGVVLMLVSIWFIVSITISSWTDSLILQPFVQAAIVAVIAIVIYVVRPKN
KVKKQHTMNH