TCDB is operated by the Saier Lab Bioinformatics Group
>tr|T0ET67|T0ET67_9BURK General bacterial porin domain protein OS=Burkholderia cenocepacia K56-2Valvano GN=BURCENK562V_C2717 PE=4 SV=1
MYATPGDVDNYDTSSRTDNAVKYTSPVVGGFQFVGMYALGGVAGKSGAGQTWSAGLSYNHGPFDAAGGYYYAANRASLAN
GVRTGWNGTSDGTFDGSLVNGGYLSAKSIGIARGALRYTFAPFTVGIDYSNAQYKADAMSAFRSTQKYDTARGFFNYQAT
ASLLVGVGYSYTKARGDTSATYHQVSAGADYVLSKRTDLYAVGAWQRANGEQRTPDGGTQAAQASIGSYGYGGTRTQGIL
NLGLRHRF