TCDB is operated by the Saier Lab Bioinformatics Group
>tr|T0SCI3|T0SCI3_9STRA Uncharacterized protein OS=Saprolegnia diclina VS20 GN=SDRG_02403 PE=4 SV=1
MLAGDRGQDRDLNQLRAAPKSPGSSAKVVPVAPKRGLYDDMDVDEDADGFVASTPVQGFNMAPPSDWASLDAELASVLAD
PTTTKQRPSATKARNDDDDDEDAVDGFVNDNPDYVRQRLEKKVQLYAAHIEAMKSRMEKWQEHKKAFVAHIHKLEERLKE
QTEAFATAEAAWEDEAMSLAKARRTNKPNYALGGSAMQGQHQLDRERSKEAVRQLLHGAADVAADDDDDDDLVNATGRSW
HQRLLAIARRLVPLSHDIKQIEARYGHSVAAYFMFCRWVLLNYLILSLPSLYFLILHISELLETHYTSWSTFTGLMPNCL
LFPSYTTNEAFAYSIYLGGTSSLFLLISTYKWLQEDRYAKLRHAAEAGRPSTFGKLLLNAWDFEATTKDDVSDLRKSLWD
SLHVALYDDIKQAEIQNRTKRERYALYARRAVAFFIYVAVQGISWGLIGLLTVEASSFAQIIKAQVPALQAYAASIVPIG
VSVINGVLPKVLGVLTNFERWDDNGFRIKAMVTRLFLAQLLNILLQLWSYAMLLDPFLSSSSEQPISWLPFAYEIRSNVM
QKFKPDAYACRAEQVASGLVVLVVTNFVTPKVTALTLSGIFGLLRLVKRLRAKRKGLELPPTDTRSEFLIAPTMVALMSS
CTLYAFAIPLCPSAGLVTVVLLTLSFKFDKLYLQAFMKKPNAPWSAKNAGVFFIKLYWCTVAVYVTGMYWFLTNVHLPKH
CDLQVRDAPFLCSSYASPSQTCVLNTTSPMSFFFQTSPTNECSAGYPGCVCATACGPFVNSTTGYSPVLNLVLTTDGVGF
FADLATTGVTLLWAIIVLLLMQVGLKANSIEATLLAGHVQDQEAKAMIAALLKKVAAQDKKLKLQKL