TCDB is operated by the Saier Lab Bioinformatics Group
>tr|T1IV20|T1IV20_STRMM MARVEL domain-containing protein OS=Strigamia maritima OX=126957 PE=4 SV=1
MATAENDGIPRNVRTPTISTGTFPSYHTTMTETNAQNTTCRFDPTYLRSLPGILKLIQITFNVVGFICVVASRGRHLSRG
NWFSFVSGVGFTISQVLLLIHVFDVPRQLATVPWLIIEIIACSLWTLLYTIAASLVAAYASHISEFGIAAFVGFAATIAY
GYNAYITICKFRSNYTDTNQPNDTNNRTPKNI