TCDB is operated by the Saier Lab Bioinformatics Group
>tr|T1YED1|T1YED1_STAAU Uncharacterized protein OS=Staphylococcus aureus subsp. aureus CN1 GN=SAKOR_02704 PE=4 SV=1
MKFRELVKQSYEDLKNLTVTWYNVIALTILVIVLSSFTTPMIGIPAGLLGGSYYLKRREEKGK