TCDB is operated by the Saier Lab Bioinformatics Group
>TFG05967.1 hypothetical protein EU536_00055 [Candidatus Lokiarchaeota archaeon]
MGESKGEGGSWLYGLILIIAGVFIVVTGILNLLGLNPLGEILGSIDPELAILASTTGWASILIGAWGFIGGVGLIKDQEW
GWGISLVILSYVIVTYLADFITIVQALIAGTITAIGIVQWIELVVVIIAAVGIVYLLLTKYKYA