TCDB is operated by the Saier Lab Bioinformatics Group
>TPP46238.1 Ion channel family protein [Leishmania donovani]
MISRTPSITEGGFDGSFPPAAASSDEQRSTTSATAAAPGGTIIAAKRRRSTFAKMKRSITKGPRLLGRRIKHFLKDDLYI
DVSYQEAPPKMVARELAALEVLSVYHRWLRGVQALLSIAVFMLSLLSIGSSAFLVNCTIFIVSQAAALVICKTYQVKAQF
SGVTNLLFEGRNIFTSPYFLHMVAEIVLWNIQTPPFVFVGKQFFELLNYFIFLRLYSVIVYLNNAMYVHRTFCRAMSAIS
DLPLSTSFLIRTGLLHHKTRVVVTVVICAWLTVGCLFARTQNLSLGDALWFSFQSLSTLGYGDITPSTLSGRVVAFIAWI
LSYVIMAFLIITMYSLLQASDRSHNMQTLMECHDLAHSLRGRSARVIQLAWRLRKARKVGPHAPSLKQKVYTLVLSWLLT
DMISAVRRTRQQLNGAVRSLSETNIHPLTGLSAYQYNAYLQLTEKAARQLQRAKDVDRVHLALRDRDVLASSLSRRDIET
IIVLPGDSLEPIGTALPVALTSSSGTAASVAEMAEWRDRVTQLEQKCARLTEVLEAISAVAETHPPSMAVSQM