TCDB is operated by the Saier Lab Bioinformatics Group
>tr|U1LZE8|U1LZE8_ASCSU Uncharacterized protein OS=Ascaris suum GN=ASU_08836 PE=4 SV=1
MPETREELFEKAKQLNESEKYDEAIEVLKELANLDIEVNNSEMELINWVVAGKIMSAGFGDEKKDACYAALEILEPIKIC
RNAEWLENYESALYECFSKLNSCVRDEERDNVWCRLKEAYLEVFKAARRVWKEKNTPERLPVYVTLSKLSKFYLDVADVE
TMSICEEAAKEAKFIGRGALSDDQYRDAGTYINEIKKNIGDAKRGKEQLKDN