TCDB is operated by the Saier Lab Bioinformatics Group
>tr|U4KLF9|U4KLF9_ACHPJ Formate/nitrite transporter superfamily protein OS=Acholeplasma palmae (strain ATCC 49389 / J233) GN=BN85410810 PE=4 SV=1
MIWNMHERGYKLKMNRYIIVLTKAILAGLLIGIAGTIYLTLDNKTVGAFLFGFGLLVICSNKLNLYTGKVGYIIDRKPNY
LIDVLIIIIGNFIGTGLIALMVNLGGLLDVVEIAKQTVLHKLDHKPLETFMLAIGCGMLMYIGVDGYYKNKNDFGKVIIV
VMAVAIFILAKFEHSIADMFYFMVSGTWNIKAFLYFIVMLLGNALGSVIINGLEKTVKRSEKIEENHITH