TCDB is operated by the Saier Lab Bioinformatics Group
>tr|U4KNM5|U4KNM5_9MOLU Uncharacterized protein OS=Acholeplasma palmae GN=BN85402230 PE=4 SV=1
MFSDINITEGENMKKILSLFLILGTLVTLVSCGIAATSRNVPEKLVVSSNSDGNRVENGLFMSHEKSETDSSFLGYGINL
VNHNQVNARNINITYPIFDLDKLSTQPLMKVYENSSEINNIEGSSMSEYIQNLETKFNLNAELKMFGKVDLKAGFTGSYS
DKSNFMFKTVNINEQSYYFALQTNPNDYVSLLSERFINDAMELPIETLVKRYGTHILTSVTMGGGINLDYTISSNSQSSA
ASLSTAIDMSVRTWFSKASGSSSMDYREEAKKSDTNVSVNMKVIGGEAVGIFAEQDIIQKYPEWQKTIATSPALMGIKDS
NSLFPIWEIVGMINDSSSAAQRRSAEIQKYFLKIGQENYSDLISQYSKEKIIFPSYIEEVSVVPEGSTETGSIQNITYKT
GVIASQDKYKINLKFDSFTNTLPTINYIVTEGQEYVKINSNGVIVPDSKKINELNQPGVNVSVEINAGTTSKTIKLYIQK
IHRIDFISNGGSDVKSINNIETGRIVYLAEEPKRLNYRFIGWYLDEELKNEYIFGTEVTSDLILYAKWERLLRVEFYDGV
LLDKLMVTVRNGQSIAEVSTPIVKEGYRFIGWYIGKDLNEKYNFGDSVTRDLILYAKWERLLTVNFVSNGQSHAVINKIV
SGTVIDKAINPQRYGYRFVGWYEDLSSTIEYNFETPITKDVTLYAKWEEKPKLTLTFEYRDNIRDNYILNNVLPESTVDL
SSTPELSSVTRTGYRFLGWFYMYEDQERSLHGDRVYSNITVYAKWEKGNITVIYQGVNGNEHSNPIDISGNAIVGLKDAN
RVGYDFLGWYNESDERITQIEGKNIIESTVVTAKWAKSKYSIEYQLNGGTKGNNPSIFEYQEVLPLNEATKDGHNFAGWY
KDSGLTVRIENTAGLTTSITVYAKWTVKQYNINYEINGGTNHSSNLSQYTYGQIQNFNAPSKFGYNFAGWYKDSSFTQSV
TSTEGGNDHITVYAKWNPEVYQITYILNGGTNSSSNKSTYYYEQNEYFSYPSKSGYDFKGWYTDSNFSNRISSTTGIMGN
ITIYAKWEKTVVKDPDPVKYEYIYNSNGQIIGVYYPDSGITIWYE