TCDB is operated by the Saier Lab Bioinformatics Group
>tr|V4HHT4|V4HHT4_9GAMM Uncharacterized protein OS=Pseudoalteromonas luteoviolacea 2ta16 GN=PL2TA16_02035 PE=4 SV=1
MNNKPKCQYTSPDGHKCQEIDMGSGYCFWHDAKFDKSGLELSHKLERYAKKGGLLQGLELKRANLEGLNLVKFNDHNGYD
LSYSNFYRANLHGAHLFNSTIQNASLMKADLRDANLHCCKLENTNILGVKLNATRIDNLVLGDKLLQEKQAIEATKQKNI
EEAQDLYLQSEEIYRLLRKGAEQQGLFEMAGKYTYSELRMRHAQYPTYSKKRLVSSFIDMLCGYGEKPENVIRFSLGMIL
LCALCYFMLGINYNGEIIQFSTNAPLKQNLHSMLNCFYFSVVTFTTLGYGDITPVGITRLIATIEAFIGSFSLALFVVVF
VKRMTR