TCDB is operated by the Saier Lab Bioinformatics Group
>tr|V4QS44|V4QS44_STRIN Membrane protein OS=Streptococcus iniae IUSA1 GN=IUSA1_07890 PE=4 SV=1
MGRDWEFPLPKDCKKEITKMQKFDPIIRLIPKMPRWLWFLVYGIIIINLSQLLADGFLFFAMVGLGVTFRGVRKRQSYLQ
NQDMAKRIQQLKDTVHLADRQKRQLSDYILNKDTENFQLTARHLLDKLQNIKSESYQLKEHLPKEVFDRINSKADEVKVE
TLLQLEHLQIEQELDSGAVFEQQIDKIAPELKAFYHNVQTDHKRILKKLEEADNTEELTAIHNSSMQQFYDILTGYLQIK
ESPKDYYNAQERLDKALEAIKTFDLDLDENLRKLNESALKDFEVSLRMMQDPRN