TCDB is operated by the Saier Lab Bioinformatics Group
>tr|V5IKW7|V5IKW7_NEUCR Mitochondrial outer membrane beta-barrel protein Tob55 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tob55 PE=4 SV=1
MASSPSAPGNPVEAATAKIDKAAAIVHQKAAAVVTEPKEPQPYQVPNPIIEDHLLTPATVNSIEIHGANNTRRGLLDHVF
KPVVEETASPTTTLGEALARISTATQKLTRFGIFKEDGFGVFISDARQQQQEQFQSPTDRTELDVSIRVKEQSRLVFKAG
TDFGNAEGSAYTNAVLRNIFGGAETLSVNAAAGTRTRSAYNAVFSTPVNGNPDIRLALEALRSSTHKPWASHDEHLTGGN
LRLAWSTDNGDDHALTYSGVWRQLTGLSASASPTVRADAGDSLKSSITHTFTRDRRDNPMLPQAGYLVRTAAELAGWGPL
KGDVSFAKSEVELSAAQALPLPGVSVGAGFRAGLLYPLPMGYSLSSTSVAPSRINDRFQLGGPTDVRGFSMGGLGPHDGA
DSVGGDVFAAGSVNMLLPLPRAGPTSPLRFQLFANGGRLVALQGKKTAEGSVSLDSGAVASGMKSAVAELANGLPSIAAG
FGLVYAHPVARFELNFSLPLVVRRGEEARKGLQVGVGINFL