TCDB is operated by the Saier Lab Bioinformatics Group
>tr|V6AI72|V6AI72_PSEAI Putative heme utilization protein OS=Pseudomonas aeruginosa MH27 OX=1306165 GN=hxuC PE=3 SV=1
MTLPFTRAAWRPLCSAAVLGAALWAAGASAAERRFDLPAQPLAASLSRLAQQAQVQVLFDESLLRGLRAPALSGSYGVRE
ALERLLVGSELELVEAGGGYVVRQRQVDAYSDNALQLDAQTIVGNGREVDASNVGRSTLTRRDIERQQADNIPSLLQTLP
GVTMGGSPKPGGQTTNIWGLGDAEDVPYTLDGAQKSGFERYQQGTVFIEPEMIKRIEVEKGPHSVFTGNGGFGGTVHMET
KDAPDLLREGRDVGAMLKYGYHSNDQQKIYSGAVFGRSEDRRVDALLYLNGRDGRDMKLADNLPLSPTDYPINPKRLPNS
AQDEKTGLFKLNLHPTEEHDLGFTYLRSKSSRWTPFSASSYPTPPSQWTIDRYGYELGLTRLLAHRDTTDTTWTGKYNYH
PLDNPWIDLQLSYSDARTEQLDRREDTAFYQLATGGKRMRTEYQDKVLELRNTSRFDTGALQHELTLGAALHKHKRDILM
HMPGKTYETPRYNYGWLQPAFMPAGKQDTQSFYIQDAITYGSLTVTPSMRFDSVRNDGQANLAPIYDNPKLGHDYRAQTY
SGWSPRLSVFWTATPNLAFFADYTETWRAPVIDEQYEVQNSSTIGGSSRDLDAERIHAIRGGSVINLPDLLVAGDSLQIR
TTLFQNRIKDEIFRTRSVGCRQQSIDNGSIGGSCGDMLPLSNYRNLPGLTIKGFEIESFYDSQRLFGSLSYSWMTGKHDG
AYSNPWGPNVWARDIPPPKWVAMLGLKVPEWDAKLGWQGEFVRKTDRLPSDRYSGGMGTGSGDIYWDHAANDSYDTHRLF
AEWVPAKLGLKDTRIDFTVDNLFNRSYRQPLGGDLVYSQGRNAKISVTQFF