TCDB is operated by the Saier Lab Bioinformatics Group
>tr|V6LJH8|V6LJH8_9EUKA Transmembrane domain-containing protein OS=Spironucleus salmonicida GN=SS50377_15365 PE=4 SV=1
MYIIIVYIKVTYFTMNQYKSYGFIHTKYCRYLHYKMHETPIEEIRRSKSINARQLHSYFGIDVSMLFQLDLFMALWFIVV
FICYLPFIISFASFDWGGQNFIIQPEYTVEMYLSISNFHCYIWYIVIMSTQIITQFFRRIRRIQDCKESLLPQVQDYSLI
IYNINQNTSNNQVFRLLISLCPFVIIRDIVRVKQPSLYKLQQQFINIQKDYYNQLQFHVENLSFNGSNSYKLLSNHHLLF
NIIQKVGFYHDFQWYESKLHSLQNKINTQAKAKSSESDAAIIIFETIQMRENILRLLYNQKLDNNILKSTRSYNPKDIIY
HNLSKKINDKHKKELLTYLIIIIVSILQFILMAVIRDQADKFTEKQYGFINQTAGLCLGLIQMIIGDWTLRSILFWAIQY
EGHTTYSSKEKSWIVKFYIFNLFNRLSVVYYKNFTLYFSDKKNHYYDFFNIFTKNRFWRFSGGHIGINLLSVLAVFTFIQ
NFANICLQIIIKGYLFLINKSSNGQNQYDLGGTIRYSSIYVQHLVVFTLTLTFGFEQPYLLLLATLFYVIQFFTLKYVQA
KVSRPPPSYNGLCCQAEKIQSFICIGSVLGIIQYNYEDNSYIYWIPLIMVSFILYQFTNSRIFTIFIKKFLNTEQGKLIS
MREEDELLHKIQNAPPFTLLCNVDNYVITVPFSQTKLEQLYDRILELKQQFKIQSFTSCTKILAWASQSGHADLCAPW