TCDB is operated by the Saier Lab Bioinformatics Group
>VDG77260.1 Uncharacterised protein family (UPF0104) [Bacillus pumilus]
MHTEAGDSRLNPARAGFTKKPAAGFSALTPETAQETAPEGPSENSPETAPAPRPTTKVLLVDAIARWQRRPANLVRGIIA
TLGVITVVLISLYGFSSTVAVTNDVANAAADVLRTVLFMPVNVLEGIISLVLPLWIILELLWNRRWRALATAAVAVAGSV
ATCYAGLWLFRHYLPYAAVTEAFSKTLNEQATIGILPYVSVISVLLTVAGQFNQSRTARWGWWLLGIVVMLSILQGMQSL
TGALFTILVGVAAACYALFAIGDAPQRAVGKAAVALVRRAGLDAVRIIRVDNIDDPLHAWEIASNAPLGYADSATFSGIS
RVLSGTAKTSSSAAKEAAAPAGAEEWAEGTAPAGATAKASAGAEGAAERTAPANAGAAVAAEGNISVSPAQVAAGPAFTT
DTTQVTEVEAALVPAPIPTQTLDIDAPSLAAQTRARYNPPITDTNSRNYVAELADGSARFLTFIDSDREIVGRLAAAWQR
IFLKASTRRTGSNIVETAERTLLMEREAAAIGAAPDRHPHAAGGNYSMVLSFDLAPRAATTPGSEPGSEPGRTSASAPCE
PGRASASASGGSIATGVETAGTATGIETAGTATGVETAGTATGVETATASGKLGNAIPLAALAAEEIPDSALDDVWRALR
TAHHAGISHQDVRASTVLVSGGRGCLIHWRNGSIASSELSRQIDLSQALTMMASAVGIERALASAQRMLSEQQLSSIAPV
LQRAIIPQETLRAFQDRKDLQRLRDSLTKEIPQAATSSGPQLTRFSLRTIITAFIGAAALFILLGSINFNELLETIRTAN
FWWALAALAAGFLAFLGAGIVLRAYTAENLKLSEVTLVQVAAGVVGLVMPAGIGPAALNLRYLQKNKVPTAVAVATVTLV
QVAQFVATVILLLVLALATGDFGGISLPSGSGLLTFLAVVGAVAAVLTIRPLRQWIIKKIRPTVQQIWPRIVWLATHPSR
IATGFGGSVLQTASLVAAFGFSLAAFGETLPITTLAITYLVSNSVGSIVPSPGGIGPVEAALTGGLVVAGIPYSVAFSTA
MLYRLTTFWIRVPVGWVALRVLQKKDII