TCDB is operated by the Saier Lab Bioinformatics Group
>tr|W0T529|W0T529_KLUMA Mitochondrial outer membrane protein OM14 OS=Kluyveromyces marxianus DMKU3-1042 GN=KLMA_20269 PE=4 SV=1
MSSEKHDVKEAGKDVGKDVKETAKEVKAAAKDKASRAAKEAHGAVDKAQDEFKKQVNNAEGILKPYWDKFVEFVSNVAST
TAGATQAAVSNVAYGTSKAASVVFHELQNPVVAVNAILGAASITTILNGYAHKKRFLKDKSDQDICLIVSGLSAFVAADA
YVSYKNYKKFDKK