TCDB is operated by the Saier Lab Bioinformatics Group
>tr|W2FT93|W2FT93_PHYPR Uncharacterized protein OS=Phytophthora parasitica GN=L915_19899 PE=4 SV=1
MENKDTDDVPGFSGMRNSWSLEAIEASVDKQMAKLTSLPADESDWSVANYESDEEDNTNDYETTTTDGFASHQPQYRQIL
VAKKLKLLEKQLQHRDRMLQKLQTTHTQAQTTIANLQNELQQAQQELVSAQEDWEEEKETILRFRGAVGGGNNAMMQIKL
GLSGGGGRSRLTEIEAQRQREMRQQMLNGAADVQEMLEADLGDGNDRAAVKGIRLKWKKLRLFIRRKLYPFTTDIRQIEA
QFGSSVASYFRFFGWIIMTFMVMSIPCFVFLVLHILYLIHQPSTTDWLTFSGVFPTFLQLPGYFPDEAFVYTVVLIWMEG
LLLLFTLRKWVAEDRMSKTVQAVENASEKPKYSRILLNAWDFSLTTQNQVSDLKKTIAEQVQLAMEEEKRAETIKSRTKK
QRYILYARRFVAFVFYVAIQAASWYLIILLTTQSSQIQLQIAEKAAIFAPYASSIVPAVVTVINAILPKLISLLTALEKW
DDVGFAIKAMVTRLYLAKILNVLIQMFSFALLLDPFLLTSTQKILDLFTFEGSTVRENVMLEFKSEVYTCRAEQVSAGLL
TLVVTDFSVSKAMAISSPFVGVVIKFLKRIWQRRREKRKQKKVKISSKVLPEDMGMSEEVANEISGQHDPDKFRISTKDA
EVILTPASENLVTKSEFLVPQKMVALLYSCTIALVAIPLAPTTALLALLLHIANFKFDKFILMHLQRKPANPWGAKDADS
FFIKFYFCTVLIFLSFTHFFLFNTRLPKQCDIQDTSDNELCLPNTYNAAQINCTIDPTLSSSLYFLNGPECSTGYPRCIC
EYSCGPFVEVEKGYTPLLSYITSSSVASAFYSLILDNNFVPWALLFMFLLAIFFLRNSLTVYIMTTLQREQDVALTYSSL
KRKIKQLENRLRLQKMGGTRLNELDGAENVKS