TCDB is operated by the Saier Lab Bioinformatics Group
>tr|W2KVR5|W2KVR5_PHYPR Uncharacterized protein OS=Phytophthora parasitica GN=L917_12454 PE=4 SV=1
MDQPRGSRAAARLSVTAPDDGPSVAVAREWFRDVILPHRVRDKEAGAFRLVDMGEDAPGSELFPVFGTSLSDLSVFGIGL
GLYFRMLLQLSLLLFVLACVSTPSIIYFLSSSYSGTLRSRSLDFRILGTAACTREVSAIDTSASSNEIRTVTINDCPLIM
TQLHVDMIGLGILAVYCLVVAVMQTRDKAHLDALEQTASDYSVVVKDPNANAWDPDEWERFFAQFGRVKFVTVCVDNDRL
LSALAKKRYMEDMLKMESADQEIVRLALENAADPTKAAPKQSLFRQFRQKFGLGGYDLTYWNAELDVLRRRIAEMLKHDS
YRVWSVFVMFETEESQRRCLRETRIGLCSTLLDWTSTGLSDRLRFRGTNILHVEQATEPSSVQWKSAGVLWRRRVLQQAL
TMSIVGGMMTGVYFLALWLKNDYIGGETEPDSKRRGRLFILACTLAVTDLFGCRILSYVDRLEQHQTKEREQLSTLNKLL
LFRGFNGAVVLYLLMDFTDILSQENLLQIQALLIANLITAPVIQLISPFEKFNRWYYGPKAKTQRKLNSYYSGAYWKLAE
RYTQITKSVGIALFFKSLLPTGLIITSLSLLVNYWVDKYCLLRKWKTPPRYDGLLARASRYHLLLVALVSLIMMGRWYNG
WPFDHATQRAVTSAREETESRYDSLVKTLHIVLPFLRDQYPTKEQQHLMDVLYWIILIVTCVVVAFVLLKSLYRSYIRYI
VGNLATGFLGGRAKQCDIPASDVSTLNGYVPSYESWYSDFPYLSVPLGTFEPRYVSWSGNHEAYCLVNDVVDDSQLAGSL
GDKPLQQLFGACKQYDMPGMKVRAPVTSLDSISLV