TCDB is operated by the Saier Lab Bioinformatics Group
>tr|W3VB60|W3VB60_PHOTE Nucleoside-binding outer membrane protein OS=Photorhabdus temperata subsp. khanii NC19 GN=PTE_00317 PE=4 SV=1
MLFAGKAHDPKSCPQFFFTLGLSSPFSCAASYLAMAWYWISTRLKQRELSAILLLLPVINQAQASDFVNFQSVDTSLYMQ
FENRVDPRKTISPILEAFGDYSVGDMYVYSIWQNSLQSDYTGDKSTYYYKLVPRVSFSKVTGNDISFGPLKDILFAQWVA
KTKGIDYDYFPGISIDWQADWISWLRTIFYFENNAKGNWNDQRIHIDYGIPFNNRLGDFRVVGTFDYTLGLHGQPKTIDF
KPELHYDLGKFLGNQPGHLWTGIVLNPIKNKYKIKDTPYYRTDQFSYGIFIRYSFF