TCDB is operated by the Saier Lab Bioinformatics Group
>tr|W9BHF5|W9BHF5_KLEPN Multidrug efflux pump subunit AcrB OS=Klebsiella pneumoniae GN=acrB_2 PE=3 SV=1
MPHFFIERPIFAWVIALFIVLTGLLSIPRLPVAQYPEVAPPGIIISVSYPGASPEVMNTSVVSLIEREISSVDNLLYFES
SSDTTGMASITVTFKPGTDIKLAQMDLQNQIKIVESRLPQSVRQNGINVEAANSGFLMMVGLKSPSGAYQEADLSDYFAR
NVTDELRRVPGVGKVQLFGGEKALRIWLDPMKLHSYGLSVTDVLSAISQQNVIVSPGRTGDEPATSSQEVTYPITVKGQL
SSVEEFRNITIKSQVSAARVTLADVARVESGLQSYAFGIRENGVPATAAAIQLSPGANAISTASGIRARLTELSGVLPEG
MTFTVPFDTAPFVKLSILKVVETFVEAMVLVFFVMLLFLHKIRCTLIPAIVAPVALLGTFTVMLLSGYSINILTMFGMIL
AIGIIVDDAIVVVENVERLMEDKKMSPQDATREAMREITPAIIGITLVLTAVFIPMAFASGSVGIIYRQFSISMAISILL
SAFLALTLTPALCATLLKPHGIHQGKSSVFSAWFNAHFHRLTSFYATGLGFVLKRTGRMMMIYAALCLALFAGLSTLPSS
FLPDEDQGYFMSSIQLPSDATMQRTLKVVDTFEEEIAHRQAVESNIMILGFGFSGSGQNSAMAFTTLKDWRQRKGTTAQE
EADHIRSQMANVPDAVTMSLLPPAISDMGTSSGFTYYLQDRGGKGYQALKKAADELIVQANHNPHLADVYIDGLGEGTSL
SLHVDREKAEAMGVSFDEINQTISVAAGSNYVNDYTNNGRVQQVIVQADAPYRMQPEQLLALSVKNRLGQMLPLSTFVTL
SWNVAPQQLIRYQGYPAIRITGSSAQGKSSGTAMAAMDNLAKHLPPGFAGEWAGSSLQEKESASQLPGLIVLSVLVVFMV
LAALYESWSIPFAVMLVVPLGLLGAVLAVSVTNMTNDVFFKVGLITLIGLSAKNAILIIEFARQLMKEGKSLIDATLTAA
KLRLRPILMTSLAFTLGVVPLMLASGASDSTQHAIGTGVFGGMISGTLLAIFFVPVFFVTITRFTGMRKYRLGNSRNG