TCDB is operated by the Saier Lab Bioinformatics Group
>WP_005822107.1 efflux RND transporter periplasmic adaptor subunit [Bacteroides fragilis]
MKRCFQLVALLAVVLLGSCTEGKDKGAAEKTEEKPKVKLADVTARPVEQIQEYTATVEAEVKNNIAPSSPVRIDKIFVEV
GDHVSQGQRLVQMDAANLKQTKLQLDNQEVEFKRIDELYKVGGASKSEWDAAKMAYDVKKTAYQNLLENTSLLSPISGVV
TARNYDSGDMYSGGNPVLTVEKITPVKLLINVSEIYFTKVKKGAPVDVKLDVYGDEAFEGKISLIYPTIDPTTRTFQVEI
QLPNQNQKVRPGMFARASLNFGTEENVVVPDLAIVKQAGAGDRYVYVYKDGKVTYNKVELGRRMGAEYELKSGVPNNSQV
VIAGQTRLINGTEVEVEK