TCDB is operated by the Saier Lab Bioinformatics Group
>WP_007131716.1 hypothetical protein [Paenibacillus lactis]
MCKWWRHAVLECRLLFGNPVFASLPVIYAILFAMNMLNSGGGTEQNLYTMAYKFHMLGHTMTLGPAMLIGILSMRRDVLR
RSFEWNHSLPVSFLTLLSSKYAVSMLYLSLFTLPTAFIFYTISISQGIAGGIAMHYTMQFAMQYEISYMVTLALAMVLGA
SIPNRIVYLIGFCAWMFGTFFMDIFIITQLGWYPAEVFHLNQFFIQSETLQYENWSYALISADISRSRWFVLAFTGLLLA
VSLLLLNRKRPTMHVKRIWAAAVAALVLAGAIFMPYGSLWAERYEQLGSKLSDPSIGLTDDPVPATIFTVSSYDLELKRL
PNDNLRVTARLRIPAGELAGKSELPLTLNRFFTLERVRIQGNDAPYRRRGEMLTISLPANSRQEIEAELVYFGSVMDYRT
DYSRNDFAAFSLGDEVKLEGHMAWYPLPGHQHVYLKQDETSSPYITLARRYGIQRYSVGDMKLKVEGYSKPLYSSLKEVE
RGPGYQIFESKGIGQNVSLYGGSFWTEVHRPDFKVRIVTTPYLEKWAEGLLTELKGKYDYFAAWIPGMSTDIDTILCLGQ
GIEWPHAEHSLILSSREYTYFSNNLPGEWVNYMLFGDQPAYYGNYEHPEQDVRNKIGSLFWYVYYIEEKGLSDKQLRSAY
GHLRSVQELLFKNGDGTDPQNKIGIGMARQVRRAMKEGKAEQVKKVLAHYYGHGLQFPDTERYPAMKPEAPVTYEEWVKR
WKQTVGE