TCDB is operated by the Saier Lab Bioinformatics Group
>WP_010120271.1 hypothetical protein [Corynebacterium nuruki]
MTAPGPGPGSLTNLRNLTNLTNKEYITMDLSALTELFGNLAGFFGGFKDVFSGLGAIFENGAALSSGSEGAAE