TCDB is operated by the Saier Lab Bioinformatics Group
>WP_012047910.1 polysaccharide biosynthesis protein [Clostridium botulinum]
MLTKFKNILKNNKFNVIFKYSFIKYIALVIGFLKEIVNAKVLGPELLGVLGNLLLILNYLSYANLGILYSMNREYILYKD
KDERKARQVIYTSFTSLFILSIFFILCGFLSKLFIFKDATGEYLIYIFLIAIFQQFKMFFINYFRLVDNFTKINIIELIN
NAGTFLLIMLFIKNYKINAVLYSMIICGFITLIYGIINCEKLKININYNILKDLIYVGIPLLIYNLGFYILTTVDRIMIL
KYLKYEELGYYTFSNQIVSATLVFITSILFLYYPKAIKILNINENFNVKKVYNSIEKYTKYVELLGVLLCIVGVIFIKPF
VNIVVPNYEASINIYRVLVLGAIASQVSYFANVFIVSNKKQMYLIFLQFLTIILSIILNYIFLKLGFKVMGVSIATMITN
IIYSAMQYLIFLKILNQRKDYFNIMLKTYYKFILFVIILLIISTLKINYYIYIMILLASVFMLYKKDINDVVKKYI