TCDB is operated by the Saier Lab Bioinformatics Group
>WP_012097341.1 hypothetical protein [Anaeromyxobacter sp. Fw109-5]
MKSVLELGARLLDAAGGVTRLVELLRGLGPALSVVTAGVGLVALTMAGRFPRGLAAAGGAALGALAAYAFRAPLALHVGV
SLAVAAPVVAVLAGAVCALAPLAFPVAAGALPGLILGLRVPIAGRAVLGGAVGALAAGVVGLLFARPFAIGCASALGGLL
VAAAGVGLAGDRPLARDLAAHPLAVVALALVLAIAGAAYQLARGETAARAPAPREPPREA