TCDB is operated by the Saier Lab Bioinformatics Group
>WP_014405270.1 hypothetical protein [Methanocella conradii]
MYGGEKGEGLPNLHVSDRAYFIGSAMLLAIVIFGLVLVTSTLMESEWTTYDMQRFYAMAQVIVDGATPYLDYQDPKPPLI
FFTLAVPTLLGQKLLGGLILVGISNFASALLLMAMAWRLYGRFSGLLAGLLFTLNVAWAQGYFVLTEPFALTFILLSTYA
LMFTENRWKYVLAGLSAGVGIGFKQYALFLIPLLLFFMYRRGELKKAPELLVGILIPLAIIFGAIFLAYGPTAGAASLYW
SYGVAGTYLSESNMGDVTSYRATDPLILAANIIMAVTVFTSLLLFAAASVVRDGHLSPLEEYFVLASLLFAGTILIRQYL
HYWILALPFLALLSTRPFRGP