TCDB is operated by the Saier Lab Bioinformatics Group
>WP_017593487.1 DUF3068 domain-containing protein [Nocardiopsis potens]
MGGDRAGGAARRSRKRVPGRNAALIAAALGAFLLTSALMLRFYVHERLAVVPSSTDLRLRMVDEDASYLDTSTWRTVEGA
EVVRQTEITGGVSAGNADWATWEMSTDTTSGSSMIGHMDRRVIVDRTTGRAVNCCGEHVGGDRAVRQAGLVLYWPAGAEP
GDRPFYDADVRSAPPMRYTGAGSAAGVPVHEYVQEVEATQVPDSARKVPASALGLERRGTVTATVWLEVERTYRIEPVSG
RLVDAEERRGGGLRGEQGGERTLLDADLSLDSGQVSGYADAAGDARLLLRAVHVWAPIALGSLGALALAAAPILRFRARD
EEEDADDDEEDESEDGGGEDGGSPGGPENGHREYRSPVP