TCDB is operated by the Saier Lab Bioinformatics Group
>WP_023919824.1 TonB-dependent receptor [Rhodobacter capsulatus]
MTCPLVPGLLPGGPALAQAVPETEGGDAATLAPIVVRHHKAGETETSEGAQEVETGEIALFGGVSGDVNAAIAALPGVQD
ETRRTVDGAFDTGTNSDTKLNLQPSRLSISGGSVNENLFMMNGVSISSTVAAEPFTATPLDKADGSTGINTIYGLHPQSQ
YIPEAFIEKVEVQTSDISAQYGGFQGGVVNYRLREPSGEKRGLYTFGYTSDALTHYSNGTPEGSNPLGRRKPEWTRREIG
FEYETPLSDRTALLFSISRNAAWGRKQLDYQYLGEDVEAETTSDFARLALRHQADDGGVFSLSAAATDYDQDWASNYAWG
YTLATRTRARSLTAQYENSFGLWDMTSSLTYATNDVENDSNVDYFANWIGRYYDNTELDGALDWCNVGALTTGYVSCMEG
GFTGDKRLDDDSLRADLKFSRALAGGELRFGAAVQKTRASRSRLKDTTAYAAFNRNFSGVCAPGDAFCNADQYAWIKVIY
PAYATTVEAHKLEAFTEWEKSWDRIDLRAGLRLDRNDVLDNTDVAPRLSLAFRPNEALRVDLGLNRYYSDDYLAYAIHDN
TPIAINRMRFSPTGDWTFYDFGHYRYTQQGLDTPYTDEIKLGMTADDPWSEGVWRLTLLDRHGRDQFAQAARTGADGKEI
NFLTNAGSSRYREARLEYDRVWDRTRLRNLDSVGLRLSGVFADNKTSASSYYDSDDALNELDLIWYRGTSYSRAEFSELT
GNYDIPVRAQVELQTSWKDGQYGLGIGADINFAYDGVRDTDVDETHTNPTYGDRPHSLFEDYRFKTYAQINLSAQARIFT
DGDREAYLKLKIANLLDDSAGPSTLQNPWVEGRSVWLGTQVTW