TCDB is operated by the Saier Lab Bioinformatics Group
>WP_024123891.1 DUF2339 domain-containing protein [Thermosynechococcus sp. NK55a]
MMEDRDDLRRRLENLEAAVAALQRSLEILQTAIFREDLSSSGVPELATQSTPPEEPAAIKAQPPAPEFPSVAPLRPVTPS
QPDWLQNWELWLNRLGIGLLLLGIGFLFRYAVELGWITDAVLVAMGLVIGTALMGLGWRLQRRAIFSQFLQGGGLATYYL
TIFAAYQFLSVMPWGVAFPLMVLVTLGAFFMSLRQNRAIFAVIGGVGGLGTPLLLYNPEMSRPLALASYTFLILLGSWAI
YAVKGWRSLLLSAFWLGWVMLRVSMTTQHLDQMVALQGILALTWLGFTVLPPWYQWRDRNRAVELYRPQKTSPQPYGQTI
APFNPVIALSLSASLWEWSATITGRVFILFGVLYLGTSLLWRRLPHPWRWVYSLTGLVLIAFGIVVRYYSNRFILAPLAI
EGLILHYLSQHYCSRPLRVIAHLWWGLLSLGFVGQLLFTAADRPPLWNLAFATHLVVLGAAAVSIRFLPPPTRPLYWTLG
YGVTMIWIQHELAPLGTGAATLVWGLFGVGLLIAGLQRDSSAVRTVALITLITTLGRLFFVDLLNLAPVGRVLLFMGFGV
TFLLLSYFFRALWRRSPVESSRMSEESPSKKSKENP