TCDB is operated by the Saier Lab Bioinformatics Group
>WP_027122517.1 hypothetical protein [Mycoplasma spumans]
MNHDKYYFDKKIKSTLKNFWILSCCLIPITLIGAILSFLYSQNSKPLIYSLSILNALIGFYGVVYFTQSISFYKFRDEIK
IRRIPKSILILSIITLTLSILSIINAFLYYTLTENYKATFSNENLLKINIFKIETYITNIALFSISIPLTILSHKLYKKL
SK