TCDB is operated by the Saier Lab Bioinformatics Group
>WP_042258648.1 DUF2339 domain-containing protein [Nocardia brasiliensis]
MPPPYVPMHGPPGGAWGGRPPMPVRGMPGPGMRPPVPPRAGPPVPHTPWWQRDGLISKLLAVAGVGVTLIGVVMLLVLAA
QAGFFGPVPRVVAGAAFSAVLVAAGMRVFDRPGGRVGGIALAATGIAGAYLDVVAVTAIYHWLHPVLGFAVALGVAAIGV
ALAMRWQSQPLAVLVVLGAAVLSPVLTTELVLLAFLIVLQLACLPVQLLRDWPYLHVVRTLPAALATFVAVAGALLDTSG
DRLRLLVAAVAVAAVGLAGTILVVRRRPADITASLALAIATVPLLSAPGMYKFDRPVATLIAAVCATVLLLVAATALVPR
IAALVQIPGHTATVAAVAGSIALLEVCVAVTDARTLPIAWFLVALGFLGVAGQRRSGVAAGLGAAFAALGALAFLNIASP
EILAAQHRSEQSLSFATALAAVLLMAVVAVGVWCARTVPALRNTAELQWIVAGIAGLYAVTAAAVSIAVATGADDGFVIG
HSAATILWMAGATASLFYGLRNLGKASAVAKLALGSGLLVTVAALAKLFLFDLATLDGLVRVAAFLVVGVLLLVVGTRYA
RAFAEAAATPPPAD