TCDB is operated by the Saier Lab Bioinformatics Group
>WP_044283503.1 efflux RND transporter permease subunit [Borreliella burgdorferi]
MLVKRIVGKPITMLILFSLLLMISLYTFSRLKVDLLPGIDIPQISIHTVYPGASPREVEESVSRVLESGLSSVKNLKNIY
SVSSKESSTVSLEFYHGTDLDLVLNEIRDALELVKSSLPSKSQTPRIFRYNLKNIPVMEIVINSVRPVSELKRYADEIIK
PGLERLDGVAIVTVNGGSKKRVLIEVSQNRLESYGLSLSRISSIIASQNLELSAGNILENNLEYLVEVSGKFKSIEEIGN
VVIAYKIPDISSGINLSPIEIKLKDIANIKTDFEDLSEYVEYNGLPSISLSVQKRSDSNSIAVSNVVMNEIEKLKLSMPK
DMKLEIASDSTDFIKASISTVVNSAYFGAMLAIFVIFFFLRSFRATIIIGISIPIAIVLTFCLMYFVNISLNIMSLAGLA
LGIGMVVDCSIVVIDNIYKYRQKGAKLISSSILGAQEMMLPITSSTFTSICVFGPFLIFKSELGVYGDFFKDFTFTIVIS
LGVSLLVAIFLVPVLSSHYVGLYTSFQKNIKNAFIRKIDAFFASIYYFLEFLYINLLNIVLNHKLIFGLIVFFSFIGSLL
LGLLLDVTTFTRGKENSITINLNFPHKTNLEYAKFYSNRFLEIVKSEAKGYKSIIATLRADRITFNVLFPLKEESRDNLT
QSVDYDSIKYKIMNRIGNLYPEFNIEPSISGNALGGGDSIKIKISANDFEYIKDYGKILVSMLKKEIPELVNPRLSISDF
QLQIGVEIDRALVYNYGIDMNTILNELKANINGVVAGQYVEKGLNYDIVLKLDRMDVKNLKDLEKIFITNSSGVKIPFSS
IATFEKTNKAESIYRENQALTIYLNAGISPDDNLTQVTAKVVDFINNKVPHKEGITLKVEGEYNEFSNIMNQFKIIIMMA
IIVVFGIMASQFESFLKPFIIIFTIPLTAIGVVLIHFLAGEKLSIFAAIGMLMLVGVVVNTGIVLVDYTGLLIKRGFGLR
EAIIESCRSRLRPILMSSLTSIIGLIPMAFSSGSGNELLKPIAFTFIGGMTASTFLTLFFIPMLFEIFSNIVSSFKSRLK
RVTSNLDVEKSFKINNSTKSSYDDLFEEDGE